"displaySubject" : "true", { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { }, { "action" : "rerender" "actions" : [ ] "includeRepliesModerationState" : "false", "initiatorBinding" : true, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ;(function($) { }); { Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetCommentForm", { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "initiatorDataMatcher" : "data-lia-kudos-id" "forceSearchRequestParameterForBlurbBuilder" : "false", } { }, { "actions" : [ }); "event" : "approveMessage", LITHIUM.Dialog({ }); "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "context" : "", "event" : "kudoEntity", ] { ] "event" : "ProductAnswer", { "disableKudosForAnonUser" : "false", { { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "}); { }); { }, } { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/216161","ajaxErrorEventName":"LITHIUM:ajaxError","token":"03NENGf2VlzzlKiXlixKy7SdLLgeu0L9DFYjl4x4rR4. } } }, { }, "actions" : [ { { }); "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "displaySubject" : "true", }, }, { "action" : "rerender" "action" : "rerender" lithadmin: [] "context" : "", ] "action" : "pulsate" LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "selector" : "#kudosButtonV2_4", { }, "context" : "", "action" : "addClassName" { { "useTruncatedSubject" : "true", "includeRepliesModerationState" : "false", } "action" : "rerender" { { return; ', 'ajax'); "actions" : [ }, "event" : "ProductAnswer", { }, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "addClassName" "event" : "MessagesWidgetEditAction", }, "action" : "rerender" count = 0; LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, ] "parameters" : { { "context" : "", { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "useCountToKudo" : "false", ] "useSubjectIcons" : "true", }, }; "actions" : [ "useTruncatedSubject" : "true", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); { schick mir bitte mal noch Dein Geburtsdatum per PN zum Abgleich hinterher, dann haben wir alles. "displayStyle" : "horizontal", "includeRepliesModerationState" : "false", } "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { "context" : "envParam:selectedMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2452728,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "parameters" : { }, var clickHandler = function(event) { // Oops, not the right sequence, lets restart from the top. "context" : "", "eventActions" : [ ] }, { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", { { { } "displaySubject" : "true", }); } }); "event" : "addMessageUserEmailSubscription", "linkDisabled" : "false" "disableKudosForAnonUser" : "false", { })(LITHIUM.jQuery); } ] }, createStorage("false"); } ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "action" : "rerender" } "event" : "addMessageUserEmailSubscription", { "context" : "envParam:quiltName,expandedQuiltName", }, "parameters" : { $('div[class*="-menu-btn"]').removeClass('active'); "context" : "envParam:quiltName", })(LITHIUM.jQuery); ] { "event" : "removeThreadUserEmailSubscription", $(document).ready(function(){ ] ] "context" : "envParam:quiltName,expandedQuiltName", "event" : "unapproveMessage", "context" : "", "useTruncatedSubject" : "true", } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2451564,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, ] "context" : "", } "actions" : [ LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useCountToKudo" : "false", "showCountOnly" : "false", "event" : "ProductAnswerComment", watching = false; Bist du sicher, dass du fortfahren möchtest? }); } { ] }, } "action" : "pulsate" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "showCountOnly" : "false", { "actions" : [ "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/216161","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8hqujV6Y4RB88kD-j0jyWMHYaLFMwbauddX_xYjYTUI. { "context" : "", "event" : "MessagesWidgetMessageEdit", } "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'U_PBjVLjY43ipHjBMBvh4QgkIZcl6zTH5aqPTsW9Ihg. } "context" : "", ] ], LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "actions" : [ }); "componentId" : "forums.widget.message-view", "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); Bist du sicher, dass du fortfahren möchtest? } "context" : "", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { } { "context" : "envParam:quiltName,product,contextId,contextUrl", ] { }, "initiatorBinding" : true, { { }, ] } ] "event" : "MessagesWidgetEditAction", { { }, LITHIUM.AjaxSupport.ComponentEvents.set({ } "componentId" : "kudos.widget.button", { "actions" : [ ] "context" : "envParam:quiltName", { } "event" : "removeMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); } LITHIUM.Dialog.options['1452387059'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useCountToKudo" : "false", "selector" : "#messageview_4", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); { { "action" : "rerender" { "accessibility" : false, } } "actions" : [ { "event" : "deleteMessage", "event" : "removeMessageUserEmailSubscription", "componentId" : "kudos.widget.button", ', 'ajax'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { "disallowZeroCount" : "false", } } else { "context" : "", "entity" : "2452464", } "context" : "", Schreib anschließend wieder hier im Beitrag. }, } } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2452464,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "actions" : [ "selector" : "#messageview_9", { "componentId" : "kudos.widget.button", ] { { "actions" : [ "actions" : [ "actions" : [ "actions" : [ { }, { "event" : "QuickReply", { "event" : "editProductMessage", { "includeRepliesModerationState" : "false", "useSimpleView" : "false", { ] "disableLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "kudoEntity", { ] "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetCommentForm", } "actions" : [ }, "action" : "rerender" "action" : "rerender" }); "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ ] "context" : "", } "action" : "rerender" ] { { "quiltName" : "ForumMessage", } "componentId" : "forums.widget.message-view", { }); "selector" : "#kudosButtonV2_7", { "actions" : [ "event" : "ProductMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/216161","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xZBA13yUCRnW-H-_HRUeDbPsukPtmKKgAV0FgBpn8D0. }, } { "event" : "editProductMessage", { "disableLabelLinks" : "false", { }, ] { "event" : "removeThreadUserEmailSubscription", { "truncateBody" : "true", "defaultAriaLabel" : "", "action" : "rerender" "actions" : [ ] } { "messageViewOptions" : "1111110111111111111110111110100101001101" }, { "action" : "rerender" "context" : "", "disableLinks" : "false", ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", logmein: [76, 79, 71, 77, 69, 73, 78], }, "componentId" : "kudos.widget.button", count = 0; LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234254}); { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "disableLabelLinks" : "false", }, "eventActions" : [ { "event" : "RevokeSolutionAction", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "useCountToKudo" : "false", Kabel-TV Ternberg BetriebsGmbH 4452 ja - Elektro Karrer GmbH 4490 ja - LUWY TV-IT GmbH & Co KG 4560 ja-Brandstetter Kabelmedien GmbH 4591 ja - Normann Engineering GmbH (Kabel … "entity" : "2452843", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ { Die HD-Freischaltung der privaten Sender auf Sky Q ist fuer Kunden von Vodafone Kabel Deutschland moeglich. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, "actions" : [ "context" : "", "event" : "ProductMessageEdit", { "context" : "", { "actions" : [ "action" : "rerender" } "event" : "MessagesWidgetEditAnswerForm", Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "event" : "kudoEntity", } "selector" : "#messageview", "linkDisabled" : "false" { { "actions" : [ }, "includeRepliesModerationState" : "false", } "initiatorBinding" : true, } Zum Ende des Monats wird Sky im Kabelnetz von Vodafone weitere SD-Sender abschalten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { LITHIUM.AjaxSupport.useTickets = false; ] "actions" : [ "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { "action" : "pulsate" } } "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); "eventActions" : [ "context" : "", }, "actions" : [ { }, "actions" : [ "disableLabelLinks" : "false", "action" : "rerender" "actions" : [ "eventActions" : [ "action" : "rerender" "useSimpleView" : "false", element.siblings('li').find('li').removeClass('active'); } "action" : "rerender" "context" : "", "context" : "", "context" : "envParam:quiltName", "context" : "envParam:quiltName,product,contextId,contextUrl", }, "event" : "editProductMessage", }, "disableKudosForAnonUser" : "false", { "actions" : [ } $(document).keydown(function(e) { "action" : "rerender" }, } "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, }, "action" : "rerender" "action" : "rerender" "action" : "rerender" "action" : "rerender" }, { "event" : "markAsSpamWithoutRedirect", { "context" : "", })(LITHIUM.jQuery); { "useSimpleView" : "false", LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); { { "event" : "AcceptSolutionAction", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "context" : "envParam:quiltName", }); { }, } ] { "context" : "envParam:quiltName,message", if ( neededkeys[count] == key ) { "action" : "rerender" { ] }, }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "context" : "envParam:entity", { ] }, "event" : "AcceptSolutionAction", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2453817 .lia-rating-control-passive', '#form_9'); }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'f3q0c0fotkMxJOO5ZI2SS0fe5hM8E9NrQmaz1-Qx_Ig. LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "revokeMode" : "true", { } "event" : "MessagesWidgetAnswerForm", }, }); "action" : "pulsate" "context" : "envParam:entity", ] ] }, } "selector" : "#messageview_3", } }, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "displaySubject" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "event" : "ProductMessageEdit", }