} { })(LITHIUM.jQuery); } "event" : "removeMessageUserEmailSubscription", "context" : "", } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "pulsate" "context" : "envParam:feedbackData", } Nun sehen Sie eine Übersicht Ihrer Rechnungen. ], $('.lia-button-wrapper-searchForm-action').removeClass('active'); }, } "event" : "MessagesWidgetEditAction", { })(LITHIUM.jQuery); // Pull in global jQuery reference "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#kudosButtonV2_1", { }, } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } { "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" count = 0; ] ] { "truncateBodyRetainsHtml" : "false", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, } { "initiatorDataMatcher" : "data-lia-kudos-id" "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ], "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] { "action" : "rerender" { }); }, $('#node-menu li.active').children('ul').show(); } watching = false; "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { ] "action" : "rerender" } "event" : "expandMessage", })(LITHIUM.jQuery); "context" : "", }, "actions" : [ Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } }, })(LITHIUM.jQuery); { } if ( key == neededkeys[0] ) { $('#custom-overall-notif-count').html(notifCount); { Gehen Sie links auf "Jahresübersicht", sehen Sie die Rechnungen des aktuellen Jahres. LITHIUM.AjaxSupport.ComponentEvents.set({ { { "quiltName" : "ForumMessage", }, "action" : "rerender" ] "disallowZeroCount" : "false", var count = 0; "context" : "", "action" : "rerender" ] } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; Er erklärt Dir, welche Möglichkeiten Du hast. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, "actions" : [ { "event" : "unapproveMessage", }, "event" : "addThreadUserEmailSubscription", })(LITHIUM.jQuery); }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223989,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ LITHIUM.AjaxSupport.useTickets = false; { // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. { }, ] lithadmin: [] "event" : "ProductAnswer", "context" : "envParam:quiltName,message,product,contextId,contextUrl", .attr('aria-expanded','false'); "context" : "lia-deleted-state", "context" : "envParam:quiltName", { }); LITHIUM.AjaxSupport.useTickets = false; { } { "quiltName" : "ForumMessage", { "defaultAriaLabel" : "", }, "initiatorDataMatcher" : "data-lia-kudos-id" return; "action" : "rerender" LITHIUM.Loader.runJsAttached(); logmein: [76, 79, 71, 77, 69, 73, 78], "messageViewOptions" : "1111110111111111111110111110100101001101" }, "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "context" : "", "selector" : "#messageview_1", } $('#node-menu li.has-sub>a').on('click', function(){ "event" : "removeThreadUserEmailSubscription", { ] "context" : "", ] "event" : "ProductAnswerComment", { "actions" : [ } "initiatorDataMatcher" : "data-lia-message-uid" { ;(function($) { "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "event" : "approveMessage", "event" : "RevokeSolutionAction", { "action" : "rerender" "accessibility" : false, } "action" : "rerender" { { ] "; "action" : "rerender" "actions" : [ { Die bisherigen GigaKombi-Vorteile wie die 10 Euro Rabatt auf die Mobilfunk-Rechnung bleiben laut Vodafone bestehen. return; ], "event" : "MessagesWidgetEditAction", "entity" : "1223975", "context" : "envParam:quiltName,message,product,contextId,contextUrl", Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau } "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-kudos-id" if ( count == neededkeys.length ) { "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" } "action" : "pulsate" "event" : "AcceptSolutionAction", LITHIUM.AjaxSupport.useTickets = false; "context" : "", ] ', 'ajax'); { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'wNnDSup8G4JW4VJbr2OAyxCwMmcOTjKOzzhLWgIqNMk. "selector" : "#messageview", "triggerEvent" : "click", { Jetzt auf einmal nach ca. { })(LITHIUM.jQuery); Jetzt passendes Angebot auswählen und online bestellen. } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", { "message" : "1223989", }); } "actions" : [ "context" : "lia-deleted-state", "context" : "", "context" : "", "action" : "rerender" ctaHTML += "Lösung noch nicht gefunden? }, $(this).removeAttr('href'); ] { "context" : "envParam:quiltName,message", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); Aktualisiere bitte Deinen Browser oder lad Dir einen neuen Browser herunter. "disableLinks" : "false", { }, "event" : "ProductAnswerComment", ] "activecastFullscreen" : false, "useCountToKudo" : "false", ] "actions" : [ } else { Das schließe ich jetzt einfach mal aus " Treueplus 2play 50 Highspeed-Internetanschluss" Ich war schon von anfang an bei Kabel Deutschland / Vodafone und habe die Red Tarife. "context" : "", "event" : "approveMessage", "actions" : [ element.siblings('li').find('ul').slideUp(); { "selector" : "#messageview_0", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditAnswerForm", }, "disableKudosForAnonUser" : "false", $('#node-menu li.active').children('ul').show(); }, }, })(LITHIUM.jQuery); }, }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland. "defaultAriaLabel" : "", }, { "action" : "rerender" { if (element.hasClass('active')) { "actions" : [ { } "entity" : "1223989", "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", ] "componentId" : "kudos.widget.button", $('.css-menu').removeClass('cssmenu-open') }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "context" : "", } else { // We made it! ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", } ;(function($) { "actions" : [ "action" : "addClassName" }, "componentId" : "kudos.widget.button", "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { }); }, }, "actions" : [ resetMenu(); ] }); "action" : "rerender" "context" : "", "actions" : [ ] "context" : "envParam:quiltName,product,contextId,contextUrl", { } "actions" : [ "context" : "envParam:entity", }, "actions" : [ "action" : "rerender" } "kudosLinksDisabled" : "false", Ihnen stehen dann also 6 GB statt 4 GB bzw. "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'wNnDSup8G4JW4VJbr2OAyxCwMmcOTjKOzzhLWgIqNMk. { "event" : "addThreadUserEmailSubscription", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", } "context" : "", { }, "message" : "1223989", "action" : "rerender" Während es den Mutterkonzern bereits seit 1984 gibt, wurde … "event" : "addThreadUserEmailSubscription", var notifCount = 0; "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ Jetzt auf einmal nach ca. "context" : "envParam:quiltName,message", // If watching, pay attention to key presses, looking for right sequence. { "event" : "MessagesWidgetEditAnswerForm", } "context" : "envParam:quiltName,product,contextId,contextUrl", "eventActions" : [ ] "actions" : [ $('.lia-button-wrapper-searchForm-action').removeClass('active'); } LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. "eventActions" : [ "event" : "MessagesWidgetEditAnswerForm", Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. "displaySubject" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $('#custom-overall-notif-count').html(notifCount); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mNSFIecYuZEpGHMw0ndZdJ-TKNGNeR0d8Ehb7zhWCGQ. }); { "action" : "rerender" "action" : "rerender" }, "actions" : [ }); $(document).ready(function(){ { Der Name steht für "voice, data and fone". Hier können Sie die Rechnungen auch einfach mit einem Klick auf den Download-Button herunterladen. "displayStyle" : "horizontal", { "event" : "ProductAnswer", window.location.replace('/t5/user/userloginpage'); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "componentId" : "kudos.widget.button", "useSimpleView" : "false", "actions" : [ }, var count = 0; }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1223979 .lia-rating-control-passive', '#form_0'); "event" : "ProductAnswer", } "action" : "rerender" ;(function($) { { } }, "actions" : [ "parameters" : { ] Mach Schluss mit Kabelsalat und zu kurzen Kabeln: Hol Dir zu Deinem Vodafone Internet & Festnetz Kabel-Tarif einen WLAN-Router und nutz die Vorzüge des kabellosen Internets. LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ] } { "context" : "", { { "actions" : [ var resetMenu = function() { if ( neededkeys[count] == key ) { } "event" : "MessagesWidgetMessageEdit", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "useSubjectIcons" : "true", "useTruncatedSubject" : "true", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetMessageEdit", } "actions" : [ { $(document).ready(function(){ "componentId" : "forums.widget.message-view", { } } "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", { { "action" : "rerender" { // Oops, not the right sequence, lets restart from the top. "forceSearchRequestParameterForBlurbBuilder" : "false", //$('#lia-body').removeClass('lia-window-scroll'); "kudosable" : "true", }); LITHIUM.AjaxSupport.ComponentEvents.set({ { ;(function($){ "action" : "pulsate" ] "action" : "rerender" { "actions" : [ }, "componentId" : "forums.widget.message-view", "disableLinks" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }); "event" : "MessagesWidgetCommentForm", var key = e.keyCode; ] { Hier findest Du alle Informationen. }, ] $(document).ready(function(){ }, "actions" : [ "context" : "envParam:quiltName,message", else { } else { "event" : "expandMessage", "disableLinks" : "false", window.location = "https://forum.vodafone.de/t5/Archiv-Mobilfunk/Hardware-Rechnung/td-p/1223975" + "/page/" + 1; "actions" : [ "actions" : [ "useCountToKudo" : "false", ] ] var handleOpen = function(event) { "event" : "QuickReply", })(LITHIUM.jQuery); "useCountToKudo" : "false", ] Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. "componentId" : "forums.widget.message-view", ;(function($) { ] eine Hülle, um es gut zu schützen. "accessibility" : false, }, } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:feedbackData", ] "action" : "rerender" "parameters" : { { }, if ( !watching ) { "}); Wurde mir vom Vodafone Team mein Neuvertrag einfach storniert und ich durfte dafür Sorge tragen, das ihre Hardware binnen 2 Wochen auf Privatenkosten-Basis, an die zurück geschickt wird. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "QuickReply", Bist du sicher, dass du fortfahren möchtest? { $(document).ready(function(){ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "disableLabelLinks" : "false", if ( watching ) { ] "action" : "pulsate" }); if ( neededkeys[count] == key ) { } "context" : "", "event" : "ProductAnswerComment", } "context" : "envParam:selectedMessage", { "actions" : [ "disableLinks" : "false", Anhang gelöscht, bitte keine persönlichen Daten in einem öffentlichen Forum posten! { { ] "event" : "MessagesWidgetEditAnswerForm", ] } "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31ba40b16ed388","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, //var height = $(window).scrollTop(); LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLabelLinks" : "false", } "actions" : [ "displaySubject" : "true", "useSubjectIcons" : "true", "action" : "pulsate" "displaySubject" : "true", } { "selector" : "#kudosButtonV2_0", "action" : "rerender" ;(function($) { "includeRepliesModerationState" : "false", { "action" : "rerender"